PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G36610.1
Common NameATHB22, ATHB-22, F13K3.1, F1O11.24, HB22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 185aa    MW: 21831.9 Da    PI: 9.122
Description homeobox protein 22
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G36610.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.57.3e-1670133257
                  T--SS--HHHHHHHHHHHH........HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox   2 rkRttftkeqleeLeelFe........knrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                  +k+ ++t+eql+ Le+ F+        ++++++ +++ +L+k+lgL+ rq+ vWFqNr+a++k+
  AT2G36610.1  70 KKKKKMTSEQLKFLERSFQeeiklnpdRKMKLNPDRKMKLSKELGLQPRQIAVWFQNRKARWKN 133
                  78999**************999999877999999****************************95 PP

2HD-ZIP_I/II87.61.6e-28991692292
  HD-ZIP_I/II  22 ekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                   kL+p+rK++l++eLglqprq+avWFqnr+AR+k+kqlE+ ye+L++++d +++e+e L++e  +L++ ++
  AT2G36610.1  99 MKLNPDRKMKLSKELGLQPRQIAVWFQNRKARWKNKQLEHLYESLRQEFDIVSREKELLQEELIQLKSMIR 169
                  59****************************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-1555136IPR009057Homeodomain-like
PROSITE profilePS5007116.11566134IPR001356Homeobox domain
SMARTSM003896.3E-1568138IPR001356Homeobox domain
PfamPF000463.5E-1370133IPR001356Homeobox domain
CDDcd000861.64E-1370135No hitNo description
Gene3DG3DSA:1.10.10.604.5E-1872141IPR009057Homeodomain-like
PRINTSPR000317.7E-5105114IPR000047Helix-turn-helix motif
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PRINTSPR000317.7E-5114130IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007131developmental stageseedling development stage
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MEYWSSSFID GASSSSFISP FYNFDHFSGN QDNRCLGTMM GAQQDILHVP LAMVESGYGE  60
ESNSFNGQEK KKKKMTSEQL KFLERSFQEE IKLNPDRKMK LNPDRKMKLS KELGLQPRQI  120
AVWFQNRKAR WKNKQLEHLY ESLRQEFDIV SREKELLQEE LIQLKSMIRE DSSCKKKQTW  180
EKACS
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible265209_at0.0
Expression AtlasAT2G36610-
AtGenExpressAT2G36610-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in siliques. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain leucine zipper class I (HD-Zip I) protein.
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00049PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G36610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G36610, AT3G28920, AT3G50890, AT5G15210, AT5G65410, AT1G14440, AT1G26960, AT1G69600, AT1G75240
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G36610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0565690.0DQ056569.1 Arabidopsis thaliana homeobox-leucine zipper family protein (At2g36610) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850266.11e-135homeobox-leucine zipper protein ATHB-22
SwissprotQ4PSR71e-137ATB22_ARATH; Homeobox-leucine zipper protein ATHB-22
TrEMBLD7LJ551e-114D7LJ55_ARALL; Predicted protein
STRINGAT2G36610.11e-135(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16602888
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  3. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  4. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]